General Information

  • ID:  hor006715
  • Uniprot ID:  P07107(2-87)
  • Protein name:  Acyl-CoA-binding protein
  • Gene name:  DBI
  • Organism:  Bos taurus (Bovine)
  • Family:  ACBP family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding
  • GO BP:  GO:0006631 fatty acid metabolic process
  • GO CC:  GO:0005783 endoplasmic reticulum; GO:0005794 Golgi apparatus

Sequence Information

  • Sequence:  SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
  • Length:  86(2-87)
  • Propeptide:  MSQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
  • Signal peptide:  NA
  • Modification:  T1 N-acetylserine;T7 N6-acetyllysine;T7 N6-succinyllysine;T16 N6-succinyllysine;T18 N6-acetyllysine;T28 Phosphotyrosine;T50 N6-acetyllysine;T54 N6-(2-hydroxyisobutyryl)lysine;T54 N6-acetyllysine;T54 N6-malonyllysine;T54 N6-succinyllysine;T76 N6-acetyllysi
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P07107-F1(AlphaFold_DB_ID)/1ACA(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    1aca.pdbhor006715_AF2.pdbhor006715_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 1142961 Formula: C445H694N114O136S3
Absent amino acids: C Common amino acids: K
pI: 6.54 Basic residues: 18
Polar residues: 18 Hydrophobic residues: 26
Hydrophobicity: -93.49 Boman Index: -18399
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 61.4
Instability Index: 2454.19 Extinction Coefficient cystines: 16960
Absorbance 280nm: 199.53

Literature

  • PubMed ID:  2881742
  • Title:  Bovine and human cDNA sequences encoding a putative benzodiazepine receptor ligand.
  • PubMed ID:  3525533
  • Title:  Complete amino acid sequences of bovine and human endozepines. Homology with rat diazepam binding inhibitor.
  • PubMed ID:  3663196
  • Title:  Amino acid sequence of acyl-CoA-binding protein from cow liv
  • PubMed ID:  1622397
  • Title:  
  • PubMed ID:  17953517
  • Title:  
  • PubMed ID:  1931985
  • Title:  
  • PubMed ID:  1518047
  • Title:  
  • PubMed ID:  8358232
  • Title:  
  • PubMed ID:  8503960
  • Title:  
  • PubMed ID:  11491287
  • Title: